PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr007809.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 423aa    MW: 47833.8 Da    PI: 6.3207
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr007809.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.4e-52161441128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eel+++yLkkkv++++++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s 
  Pbr007809.1  16 VPPGFRFHPTEEELLQYYLKKKVSNQTIDL-DVIRDVDLNKLEPWDIQEKCKIgttPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVICS- 111
                  69****************************.9***************964444222455************************************99. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  + + +g++ktLvfykgrap+g+k+dW+mheyrl
  Pbr007809.1 112 NCRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 144
                  8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.28E-5810178IPR003441NAC domain
PROSITE profilePS5100556.23616178IPR003441NAC domain
PfamPF023654.2E-2817144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MAPENMSISV NGQSQVPPGF RFHPTEEELL QYYLKKKVSN QTIDLDVIRD VDLNKLEPWD  60
IQEKCKIGTT PQNDWYFFSH KDKKYPTGTR TNRATAAGFW KATGRDKVIC SNCRRIGMRK  120
TLVFYKGRAP HGQKSDWIMH EYRLDDNNTS NCNITNVSTV MGEAAQDEGW VVCRIFKKKN  180
LHKSLSSPIL SSTTSSIITD TRSGQSLFDS CPDGALEQIL QYMERTCKEE ENEAYINNIS  240
TRFNLQPINT GISNTSNHNG FHERFSKRPT LDSPNSTSSQ DCYQPNIHEE MMVTEKNNNQ  300
VSPFTDNHQN MDYDAHHMDS GLTSWAALDH LVASQLNGQT EASSQLACFS TDPHNTIVYD  360
NNDHDHELQL PSTLRGSLSS SNKSYHATHH YNNSEIDLWN FDRQSASLSS SDTLCLVSNG  420
PI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-501618015170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ9199630.0KJ919963.1 Eriobotrya japonica NAC2 transcription factor (NAC2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009366608.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-136NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0H3VAS80.0A0A0H3VAS8_9R
STRINGVIT_15s0048g02660.t011e-164(Vitis vinifera)
STRINGPOPTR_0014s10060.11e-164(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-122NAC family protein